Phosphorylase B

overview | features and specs | data sets | literature

Product Overview
Protea's Mass Spec Grade Protein Standards are for use in mass spectrometry, molecular biology, and life science laboratories. These products are high quality standards for use in the calibration of protein analyses by electrospray ionization (ESI) and MALDI mass spectrometry analyses. The Protein Standards also provide an excellent sample for proteomics method development, enzymatic digestion studies, and characterization of LC-MS analytical systems. For quality assurance and standardization purposes, each standard protein is provided with a high-resolution mass spectrum of the protein.
Features and Specifications
Features:
  • Certified Mass Spec Grade
  • Wide range of molecular weights available
  • Lyophilized for longer storage stability and easy reconstitution in sample buffers


Research Applications:
  • Calibration and standardization of protein analysis by ESI- and MALDI-MS
  • Enzymatic digestion and characterization of LC-MS systems
  • Molecular weight markers for SDS-PAGE gels

Specifications:
  • Source: rabbit muscle
  • Protein Molecular Weight(Da): 97158
  • SwissProt Accession Number: P00489
  • Protein Sequence:
    SRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFT
    LVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYE
    KDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQ
    LGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGL
    AAYGYGIRYEFGIFNQKICGGWQMEEADDWLRYGNPWE
    KARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDT
    PVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAV
    LDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATL
    QDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHP
    SLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
    PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAF
    PGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVA
    RIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVL
    CNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIR
    DVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRI
    HEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGK
    AAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLE
    NYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLN
    GALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLD
    QRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKD
    IVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWT
    RMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPA
    PDEKIP

Data Sets

(click image(s) above to enlarge)
Literature
***Please to download documentation.

Phosphorylase B Availability
Phosphorylase B
5 mg
***this product must be shipped cold, requiring 1 or 2 day shipping
PS-126-11$89.30add to cart
Phosphorylase B
3 x 5 mg
***this product must be shipped cold, requiring 1 or 2 day shipping
PS-126-33$227.72add to cart


Recently Viewed Products:

Phosphorylase B

...innovation for bioanalytics